This guide will show you how to build custom Docker images both for Spark Executor (or Worker) and Notebook (or Spark Driver). You can use these custom-built images with libraries in distributed Spark jobs and/or Jupyter Notebooks.
There are 16 docker images published in total. Customize one or more according to your DL Framework (TensorFlow v1, TensorFlow v2, Pytorch or MxNet), Processor Type (CPU or GPU), and Execution Type (Spark Executor or Spark Driver/Jupyter Notebook).
Here is the list of published docker images:
# CPU based Notebook images for each DL Framework supported
"mesosphere/jupyter-service:727a04a69058c382134533cbdbeaf6e5e9f11918c83bce4eff90bd46de193339-notebook-tensorflow-2.1.0"
"mesosphere/jupyter-service:a699c3aa92cf6ea85b6c02fe43274fa2547e1a6a8fa7a6913e3bf54d20c732bc-notebook-tensorflow-1.15"
"mesosphere/jupyter-service:3cfe8de8c8b04549ebda811bf9461925d15473364dfe5e77dfca34852d9f9046-notebook-pytorch-1.4.0"
"mesosphere/jupyter-service:7c0ff9159bc36ada373d0f811cb5dc90668b727de8f11e167b35c6c8d39678df-notebook-mxnet-1.6.0"
# GPU based Notebook images for each DL Framework supported
"mesosphere/jupyter-service:545a45c5926f006faf98ff1f70e868bf7bf28b43efc553743e3ebee79820c1da-notebook-tensorflow-2.1.0-gpu"
"mesosphere/jupyter-service:3098ffb9417f21c5c640508e671df04d4fa294fbe0f3e79e048782fe9f8e6132-notebook-tensorflow-1.15-gpu"
"mesosphere/jupyter-service:59f5739641f58f79861d4a248e14a25b31e6e5570bd371f9bd052cfc15df0c81-notebook-pytorch-1.4.0-gpu"
"mesosphere/jupyter-service:6c02651260bf094077bc2963e48bb5abc0d437924ab3b5305481e197ff6b6926-notebook-mxnet-1.6.0-gpu"
# CPU based Worker images for each DL Framework supported
"mesosphere/jupyter-service:b51ef1a82b207380ae268ae94dfb4e49156cc7ad21d42edf7ee70da26b1cb2c9-worker-tensorflow-2.1.0"
"mesosphere/jupyter-service:0a104439d74f74ece0ea82650df74b673d0e7c4c03e9aee725e85aa42a6d4b74-worker-tensorflow-1.15"
"mesosphere/jupyter-service:0ef22682b45fde63038ebda6f4edce4620db45e72f44365f4c6cdcf4e3ead81b-worker-pytorch-1.4.0"
"mesosphere/jupyter-service:5f4660355a05c8e10675e4f5064e1d77c7eea1a9e94f4b2bd9522165f38a3fdf-worker-mxnet-1.6.0"
# GPU based Worker images for each DL Framework supported
"mesosphere/jupyter-service:ea9c3ed28ef2464bb4e6ff2e24fb227eabeca8939d0e58f7b5f228e224cf8dbf-worker-tensorflow-2.1.0-gpu"
"mesosphere/jupyter-service:d6b71dbc4fc689cf621ac27588e839b991fa65c39e16e2dddc5753f82836f271-worker-tensorflow-1.15-gpu"
"mesosphere/jupyter-service:42ddb7d996734154b63e15d271f953e6e16fca2f8dc31492299e649b4578f769-worker-pytorch-1.4.0-gpu"
"mesosphere/jupyter-service:c9017c0afeb7f13000d9457c4a5a54e6864a983553604658acca5dde94100094-worker-mxnet-1.6.0-gpu"
Customize Notebook Image
- 
Choose the image to customize: Suppose you want to make a library available for notebooks as well as workers and you have planned it to run on CPU with Pytorch, then pick these two images to customize:
mesosphere/jupyter-service:cea0efa8e0578237d4247568be579904e0af1da4834ed17f166f06f7ef5be0f2-notebook-mxnet-1.6.0 - 
Create a Dockerfile: We will use
@jupyterlab/fasta-extensionas an example. On your personal laptop or server, createDockerfilewith the following content:FROM mesosphere/jupyter-service:cea0efa8e0578237d4247568be579904e0af1da4834ed17f166f06f7ef5be0f2-notebook-mxnet-1.6.0 RUN ${CONDA_DIR}/bin/jupyter labextension install --no-build \ @jupyter-widgets/jupyterlab-manager@2.0.0 \ @jupyterlab/fasta-extension@2.0.0 \ && ${CONDA_DIR}/bin/jupyter lab build --minimize=False --dev-build=False - 
Build and push the Dockerfile: From directory where Dockerfile has been created, run the commands
docker buildanddocker pushas shown below. Assuming that the docker repository name isdocker123and image name isjupyter-with-extension:notebook, the commands will be:docker build -t docker123/jupyter-with-extension:notebook . docker push docker123/jupyter-with-extension:notebook - 
Run the service with custom image: You could specify this custom built image in the config of the service as follows:
{ "advanced": { "jupyter_notebook_image": "docker123/jupyter-with-extension:notebook" } } 
Example Notebook for Custom Notebook Image
In the following example, you will use an extension that we installed in a custom image.
Open a Python Notebook and put the following in a code cell:
from IPython.display import display
 
def Fasta(data=''):
    bundle = {}
    bundle['application/vnd.fasta.fasta'] = data
    bundle['text/plain'] = data
    display(bundle, raw=True)
 
Fasta(""">SEQUENCE_1
MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG
LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK
IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL
MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL
>SEQUENCE_2
SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI
ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH""")
Expected output would be:

Customize Worker Image
- 
Choose an image to customize: Suppose you want to make a library available for workers or Spark executors and you have planned it to run on CPU with MxNet, then you need to pick this image to customize.
mesosphere/jupyter-service:5f4660355a05c8e10675e4f5064e1d77c7eea1a9e94f4b2bd9522165f38a3fdf-worker-mxnet-1.6.0 - 
Create a Dockerfile: We will use
conda install -yq spacyas an example, and will installspacyfor demo purposes. On your personal laptop or server, createDockerfilewith the following content:FROM mesosphere/jupyter-service:5f4660355a05c8e10675e4f5064e1d77c7eea1a9e94f4b2bd9522165f38a3fdf-worker-mxnet-1.6.0 RUN conda install -yq spacy - 
Build and push the Dockerfile: From each directory where Dockerfile has been created, run the commands
docker buildanddocker pushas shown below. Assuming that the docker repository name isdocker123and image names arespacy-example:notebookandspacy-example:worker, run the following commands:docker build -t docker123/spacy-example:worker . docker push docker123/spacy-example:worker - 
Run the service with custom image: Specify these custom built images in the config of the service as follows:
{ "advanced": { "jupyter_worker_image": "docker123/spacy-example:worker" } }Or you could directly specify this image in the configuration of the Spark Job as follows:
spark = SparkSession.builder.config("spark.mesos.executor.docker.image", "docker123/spacy-example:worker").appName("SparkJobName").getOrCreate() 
Example Notebook for Custom Worker Image
In the following example, use a user-defined function to import a library we installed in a custom image.
Open a Python Notebook and put the following in a code cell:
import pyspark
from pyspark.sql import SparkSession
spark = SparkSession.builder.config("spark.mesos.executor.docker.image", "docker123/spacy-example:worker").appName("Test UDF").getOrCreate()
from pyspark.sql.types import StringType
def test_func(x):
    import spacy
    return x
spark.udf.register("test_func", test_func, StringType())
spark.range(1, 20).registerTempTable("test")
spark.sql("SELECT test_func(id) from test").collect()
spark.stop()
The expected output would be:
[Row(test_func(id)='1'),
 Row(test_func(id)='2'),
 Row(test_func(id)='3'),
 Row(test_func(id)='4'),
 Row(test_func(id)='5'),
 Row(test_func(id)='6'),
 Row(test_func(id)='7'),
 Row(test_func(id)='8'),
 Row(test_func(id)='9'),
 Row(test_func(id)='10'),
 Row(test_func(id)='11'),
 Row(test_func(id)='12'),
 Row(test_func(id)='13'),
 Row(test_func(id)='14'),
 Row(test_func(id)='15'),
 Row(test_func(id)='16'),
 Row(test_func(id)='17'),
 Row(test_func(id)='18'),
 Row(test_func(id)='19')]
Data Science Engine Documentation